PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000124992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 417aa    MW: 46130.6 Da    PI: 7.3522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000124992genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
    MDP0000124992 14 RGPWSPEEDAKLKSYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding37.26.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    MDP0000124992  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.417962IPR017930Myb domain
SuperFamilySSF466892.25E-2611109IPR009057Homeodomain-like
SMARTSM007175.6E-131364IPR001005SANT/Myb domain
PfamPF002496.3E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-251569IPR009057Homeodomain-like
CDDcd001675.22E-101662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.6E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2370117IPR009057Homeodomain-like
CDDcd001673.92E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDAKLKSYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
QRKEHQLARK SGLVKQDIIK RSGGVGGNSN SHSGILAADG QNSYWPELPV LAVPTVLPQQ  180
QQQPCFNDHA SIRKLLIKLG GRFSSNHDTN QATQDSSTDI QPTFQVLDDN NNIPYAATAV  240
TPTHQMDEHY SGKNMQSLLV PRHGIHALNS SSAPVALSNI DVISPHQFAQ THYMVNTDNI  300
DGAGNGIMHN MFQGXGGNYV TDQLKEMAVY NNNNTDNQQR FDGMEYLYGD EMMIMNNRIV  360
SSYGESIGWG EMLGCPPVAS SSDDYNAGMD RLMPAAPVQE CGFANDQLMS SYPGAPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351960.10.0PREDICTED: transcription factor RAX3-like
RefseqXP_008393677.10.0PREDICTED: transcription factor RAX3-like
TrEMBLM5XI081e-151M5XI08_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0002s11440.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-80myb domain protein 84